PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA12G0163500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 311aa    MW: 33742.3 Da    PI: 8.5658
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA12G0163500.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA99.14.5e-31150206158
          CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                        d+p+YVNaKQy++I++RR++Rak+e+e++l  k+rkpylheSRh hA+rR+RgsgGrF
  ORGLA12G0163500.1 150 DAPIYVNAKQYSAIIRRRHARAKAERENRL-VKARKPYLHESRHLHAMRRARGSGGRF 206
                        68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.5E-34148209IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.424149209IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.0E-23152174IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.1E-28152206IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860154174IPR018362CCAAT-binding factor, conserved site
PRINTSPR006166.0E-23183206IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MMSFNKSQEG FGQVAAVATL ASNGGGSLPW LLYGEPLGQG KPAMSPEGVV PRAQTPLDPP  60
QVPAMDRGVP EILYFSMVPG KGEKCSEHST TIALQSPFAE YNGCFELGLG QSVVPSNYPY  120
ADQHYGLLSP YGVRPTPSGR ILIPPNMPAD APIYVNAKQY SAIIRRRHAR AKAERENRLV  180
KARKPYLHES RHLHAMRRAR GSGGRFLNTK KEANGKTTGG GRKVMDIIIP PLCPAASPSS  240
EQCNPSSVSS LSGSEVSSIY EHEDMDHFHS FDHLRTHFFT PLPSLMDVEH GAGNPFKWTA  300
ASDGCCDLLK A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-17150212264NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880320.0AB288032.1 Oryza sativa Japonica Group OsHAP2F mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK0737420.0AK073742.1 Oryza sativa Japonica Group cDNA clone:J033067G24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618449.10.0PREDICTED: nuclear transcription factor Y subunit A-10
RefseqXP_015618450.10.0PREDICTED: nuclear transcription factor Y subunit A-10
TrEMBLI1R7X90.0I1R7X9_ORYGL; Uncharacterized protein
STRINGORGLA12G0163500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23073790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.32e-29nuclear factor Y, subunit A10